| Read Date | 2008-08-28 09:41:00 |
|---|---|
| Read Number | X0000103231286200808280941 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0946 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium carbonate | 7.0 | 0.1 M | C(=O)([O-])[O-].[K+].[K+] |
| PEG 400 | 7.0 | 60.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | CdR103D |
|---|---|
| Spine Status | crystal hits |
| Length | 248 aa |
| Mass | 27.17 kD |
| ext | 36900 |
| pI | 4.66 |
| Name | Putative iron transport system binding (Secreted) protein |
| Database References | NCBI UniProt |
| PFAM | PF01497 |
| PDB Structures | 3LI2 (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium diphtheriae |
| Genus | Corynebacterium |
| Species | diphtheriae |
| Strain | |
| Sequence | SSIRVVALDWRYEEILHALGITPVGIVEIGKSKEPQTLKGELEGVTSVGQAKQPNLEVIQSLEPDLILASPTRQAAIMDQLKEIAPTHAYGDTSYTEVLDAMDDIATKVGAEDKAKEVRTRIESKIAQAKNKVEPGTRTALIGWSKNTLYTWVKDSFAGSLLTAAGYEYGYDGEKSAIESKTDVAELTGDKLPEMKLDVMYLYNDIEGFRSSPYADVVSNIVDVEQDTWSRSRGPLAAEAMLDQIINS |