| Read Date | 2008-09-05 10:14:00 |
|---|---|
| Read Number | X0000103331249200809051014 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0169 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium molybdate dihydrate | 7.0 | 1.4 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | BuR228B |
|---|---|
| Spine Status | X-Ray structure |
| Length | 72 aa |
| Mass | 7.73 kD |
| ext | 1490 |
| pI | 6.93 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF07969 |
| PDB Structures | 3GGM (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus thuringiensis |
| Genus | Bacillus |
| Species | thuringiensis |
| Strain | |
| Sequence | NVPDMILYNGKITTLDPSQPEVSAIAITDGLITAVGGDELLNSATEKTKKIDLKRKRAIPGLNDSHIHVIRG |