| Read Date | 2008-09-12 10:06:00 |
|---|---|
| Read Number | X0000103421150200809121006 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1320 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES monohydrate | 6.5 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Jeffamine M-600 reagent | 6.5 | 30.0 % (v/v) | C1=CC(=CC=C1N=C(N)N=C(N)N… |
| Cesium chloride | 6.5 | 0.1 M | [Cs+].[Cl-] |
![]() | MtR3 |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 68 aa |
| Mass | 7.24 kD |
| ext | 1490 |
| pI | 4.95 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF08984 |
| PDB Structures | 2K53 (Best Match) |
| Gene | |
|---|---|
| Organism | Moorella thermoacetica |
| Genus | Moorella |
| Species | thermoacetica |
| Strain | |
| Sequence | MATITKEMSITEVVSKYPQTVPVFMEHGMGCLGCAAARFENIEQGALAHGIDVDGLIADLNKVANKAE |