| Read Date | 2008-09-12 10:49:00 |
|---|---|
| Read Number | X0000103441526200809121049 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1342 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium chloride | 9.0 | 0.1 M | [Na+].[Cl-] |
| Bicine | 9.0 | 0.1 M | O=C(O)CN(CCO)CCO |
| PEG MME 550 | 9.0 | 20.0 % (v/v) | COCCOCOCCOCOCCOCOCCOCOCCO… |
![]() | ClR9A |
|---|---|
| Spine Status | good HSQC collected |
| Length | 68 aa |
| Mass | 7.38 kD |
| ext | 1490 |
| pI | 4.85 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF08984 |
| PDB Structures | 2K53 (Best Match) |
| Gene | |
|---|---|
| Organism | Caldicellulosiruptor saccharolyticus |
| Genus | Caldicellulosiruptor |
| Species | saccharolyticus |
| Strain | |
| Sequence | MPRITTDTIIADVLRIDRGTIPIFLNNGLHCLGCPSAQGESIEEACALHGIDAQKLVDELNEYLKSKG |