| Read Date | 2005-11-03 09:09:00 |
|---|---|
| Read Number | X0000060581285200511030909 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0178 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Sodium nitrate | 9.0 | 2.6 M | [Na+].[O-][N+]([O-])=O |
![]() | MaR30 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 68 aa |
| Mass | 7.61 kD |
| ext | 1490 |
| pI | 4.78 |
| Name | Conserved protein |
| Database References | NCBI UniProt |
| PFAM | PF01938 |
| PDB Structures | 1YEZ (NMR) |
| Gene | |
|---|---|
| Organism | Methanosarcina mazei |
| Genus | Methanosarcina |
| Species | mazei |
| Strain | |
| Sequence | MFREESRSVPVEEGEVYDVTIQDIARQGDGIARIEGFVIFVPGTKVGDEVRIKVERVLPKFAFASVVE |