| Read Date | 2008-09-12 09:42:00 |
|---|---|
| Read Number | X0000103491284200809120942 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1137 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium chloride | 6.0 | 2.0 M | [Na+].[Cl-] |
| MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | CdR101F |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 91 aa |
| Mass | 9.53 kD |
| ext | 0 |
| pI | 8.32 |
| Name | Putative secreted protein |
| Database References | NCBI UniProt |
| PFAM | PF13180 |
| PDB Structures | 2KL1 (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium diphtheriae |
| Genus | Corynebacterium |
| Species | diphtheriae |
| Strain | |
| Sequence | HKPVDTVVAHISPEAPAAKVMAEGDVITQVAGAKATGPSQVRDAVRAKKPGETISIGFLRDGKQLTREVTLGTHPEDDKVAFLGVSMTARP |