| Read Date | 2009-06-18 13:12:00 |
|---|---|
| Read Number | X0000110901492200906181312 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | phase |
| Cocktail | 9_C1525 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 0.6 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | LmR166B |
|---|---|
| Spine Status | X-Ray structure |
| Length | 91 aa |
| Mass | 9.88 kD |
| ext | 5960 |
| pI | 4.99 |
| Name | Lmo2051 protein |
| Database References | NCBI UniProt |
| PFAM | PF13180 |
| PDB Structures | 3I18 (Xray) |
| Gene | |
|---|---|
| Organism | Listeria monocytogenes |
| Genus | Listeria |
| Species | monocytogenes |
| Strain | |
| Sequence | VKVTYDGVYVLSVKDDVPAADVLHAGDLITEIDGNAFKSSQEFIDYIHSKKVGDTVKINYKHGDKNEQADIKLTAIDKKGTPGIGITLVDD |