X0000110931352200906181147
| Read Date | 2009-06-18 11:47:00 |
|---|---|
| Read Number | X0000110931352200906181147 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1046 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| Ala-Ala | 7.0 | 0.2 % (w/v) | O=C(NC(C(=O)O)C)C(N)C |
| Ala-gly | 7.0 | 0.2 % (w/v) | O=C(NCC(=O)O)C(N)C |
| Gly-asp | 7.0 | 0.2 % (w/v) | O=C(NC(C(=O)O)CC(=O)O)CN |
| L-seryl-L-glutamic acid | 7.0 | 0.2 % (w/v) | O=C(NC(C(=O)O)CCC(=O)O)C(… |
| Gly-phe | 7.0 | 0.2 % (w/v) | c1ccc(cc1)CC(C(=O)O)NC(=O… |
| Tacsimate | 7.0 | 55.0 % (v/v) | missing |
 | CgR66B |
|---|---|
| Spine Status | HSQC collected |
| Length | 138 aa |
| Mass | 13.81 kD |
| ext | 1490 |
| pI | 3.81 |
| Name | Predicted drug exporters of the RND superfamily (Drug exporter, RNDsuperfamily) |
| Database References | NCBI UniProt |
| PFAM | PF03176 |
| PDB Structures | 3HHD (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | VLGSSEARDGQQALGEHFPGGSGSPAYIIVDETQAAQAADVVLNNDNFETVTVTSADSPSGSAPITADGIVPLGSGTAPGPVVVEGQVLLQATLVEAPDSEEAQKAIRSIRQTFADENISAVVGGVTATSVDTNDASI |