| Read Date | 2009-06-18 11:50:00 |
|---|---|
| Read Number | X0000110931113200906181150 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0543 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Potassium phosphate tribasic | 5.0 | 0.1 M | [K+].[K+].[K+].[O-]P([O-]… |
| PEG 8000 | 5.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | CgR66B |
|---|---|
| Spine Status | HSQC collected |
| Length | 138 aa |
| Mass | 13.81 kD |
| ext | 1490 |
| pI | 3.81 |
| Name | Predicted drug exporters of the RND superfamily (Drug exporter, RNDsuperfamily) |
| Database References | NCBI UniProt |
| PFAM | PF03176 |
| PDB Structures | 3HHD (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | VLGSSEARDGQQALGEHFPGGSGSPAYIIVDETQAAQAADVVLNNDNFETVTVTSADSPSGSAPITADGIVPLGSGTAPGPVVVEGQVLLQATLVEAPDSEEAQKAIRSIRQTFADENISAVVGGVTATSVDTNDASI |