| Read Date | 2009-06-18 11:55:00 |
|---|---|
| Read Number | X0000110930728200906181155 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1478 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium nitrate | 7.0 | 2.5 M | [O-][N+]([O-])=O.[NH4+] |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | CgR66B |
|---|---|
| Spine Status | HSQC collected |
| Length | 138 aa |
| Mass | 13.81 kD |
| ext | 1490 |
| pI | 3.81 |
| Name | Predicted drug exporters of the RND superfamily (Drug exporter, RNDsuperfamily) |
| Database References | NCBI UniProt |
| PFAM | PF03176 |
| PDB Structures | 3HHD (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | VLGSSEARDGQQALGEHFPGGSGSPAYIIVDETQAAQAADVVLNNDNFETVTVTSADSPSGSAPITADGIVPLGSGTAPGPVVVEGQVLLQATLVEAPDSEEAQKAIRSIRQTFADENISAVVGGVTATSVDTNDASI |