Read Date | 2009-06-18 12:00:00 |
---|---|
Read Number | X0000110930408200906181200 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 9_C0990 |
Screen | HWI Generation 9 |
Name | pH | Concentration | SMILES |
---|---|---|---|
HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
Leu-gly-gly | 6.8 | 0.3 % (w/v) | O=C(NCC(=O)O)CNC(=O)C(N)C… |
Gly-tyr | 6.8 | 0.3 % (w/v) | O=C(O)[C@@H](NC(=O)CN)Cc1… |
Gly-phe | 6.8 | 0.3 % (w/v) | c1ccc(cc1)CC(C(=O)O)NC(=O… |
![]() | CgR66B |
---|---|
Spine Status | HSQC collected |
Length | 138 aa |
Mass | 13.81 kD |
ext | 1490 |
pI | 3.81 |
Name | Predicted drug exporters of the RND superfamily (Drug exporter, RNDsuperfamily) |
Database References | NCBI UniProt |
PFAM | PF03176 |
PDB Structures | 3HHD (Best Match) |
Gene | |
---|---|
Organism | Corynebacterium glutamicum |
Genus | Corynebacterium |
Species | glutamicum |
Strain | |
Sequence | VLGSSEARDGQQALGEHFPGGSGSPAYIIVDETQAAQAADVVLNNDNFETVTVTSADSPSGSAPITADGIVPLGSGTAPGPVVVEGQVLLQATLVEAPDSEEAQKAIRSIRQTFADENISAVVGGVTATSVDTNDASI |