| Read Date | 2009-06-18 12:01:00 |
|---|---|
| Read Number | X0000110930306200906181201 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0881 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Potassium phosphate monobasic | 9.0 | 0.1 M | [K+].[O-]P(=O)(O)O |
| PEG 400 | 9.0 | 40.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | CgR66B |
|---|---|
| Spine Status | HSQC collected |
| Length | 138 aa |
| Mass | 13.81 kD |
| ext | 1490 |
| pI | 3.81 |
| Name | Predicted drug exporters of the RND superfamily (Drug exporter, RNDsuperfamily) |
| Database References | NCBI UniProt |
| PFAM | PF03176 |
| PDB Structures | 3HHD (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | VLGSSEARDGQQALGEHFPGGSGSPAYIIVDETQAAQAADVVLNNDNFETVTVTSADSPSGSAPITADGIVPLGSGTAPGPVVVEGQVLLQATLVEAPDSEEAQKAIRSIRQTFADENISAVVGGVTATSVDTNDASI |