| Read Date | 2009-06-25 13:31:00 |
|---|---|
| Read Number | X0000110930828200906251331 |
| Week | 2 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1395 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MPD | 6.5 | 45.0 % (v/v) | CC(O)CC(C)(C)O |
| Ammonium acetate | 6.5 | 0.2 M | O=C(O)C.N |
| Bis-Tris | 6.5 | 0.1 M | OCCN(C(CO)(CO)CO)CCO |
![]() | CgR66B |
|---|---|
| Spine Status | HSQC collected |
| Length | 138 aa |
| Mass | 13.81 kD |
| ext | 1490 |
| pI | 3.81 |
| Name | Predicted drug exporters of the RND superfamily (Drug exporter, RNDsuperfamily) |
| Database References | NCBI UniProt |
| PFAM | PF03176 |
| PDB Structures | 3HHD (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | VLGSSEARDGQQALGEHFPGGSGSPAYIIVDETQAAQAADVVLNNDNFETVTVTSADSPSGSAPITADGIVPLGSGTAPGPVVVEGQVLLQATLVEAPDSEEAQKAIRSIRQTFADENISAVVGGVTATSVDTNDASI |