| Read Date | 2009-06-19 12:18:00 |
|---|---|
| Read Number | X0000111021534200906191218 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1344 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| PEG 20000 | 9.0 | 10.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bicine | 9.0 | 0.1 M | O=C(O)CN(CCO)CCO |
| 1,4-Dioxane | 9.0 | 2.0 % (v/v) | O1CCOCC1 |
![]() | CdR30B |
|---|---|
| Spine Status | good HSQC collected |
| Length | 58 aa |
| Mass | 6.05 kD |
| ext | 0 |
| pI | 4.46 |
| Name | 50S ribosomal protein L25 (General stress protein CTC) |
| Database References | NCBI UniProt |
| PFAM | PF03990 |
| PDB Structures | 4OJP (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium diphtheriae |
| Genus | Corynebacterium |
| Species | diphtheriae |
| Strain | |
| Sequence | VADNDTVTVRTSKQVSVVIDGVKKDVTTNAITVEELFSQLNDVPAALSSASLNVEKGA |