| Read Date | 2009-07-23 16:16:00 |
|---|---|
| Read Number | X0000111031004200907231616 |
| Week | 5 |
| Verified Crystal | Crystal |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1031 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| 1-Pentanesulfonic acid sodium salt monohydrate | 6.8 | 0.2 % (w/v) | [Na+].[O-]S(=O)(=O)CCCCC |
| Salicylamide | 6.8 | 0.2 % (w/v) | O=C(c1ccccc1O)N |
| Cytosine | 6.8 | 0.2 % (w/v) | O=C(O)C(N)CSCC[C@@H](C(=O… |
| 4-Aminobutyric acid | 6.8 | 0.2 % (w/v) | C(CC(=O)O)CN |
![]() | SnR124A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 149 aa |
| Mass | 17.01 kD |
| ext | 15470 |
| pI | 4.82 |
| Name | Molecular chaperon |
| Database References | NCBI UniProt |
| PFAM | PF00011 |
| PDB Structures | 3GLA (Best Match) |
| Gene | |
|---|---|
| Organism | Synechococcus sp. |
| Genus | Synechococcus |
| Species | elongatus |
| Strain | |
| Sequence | MALVRFSPLYEFDRELGTLQRQMSRFLQPWPWTEAELKELSFAPAVEVKETDAAIELRVELPGIDPKDLDLQVTAEAVVLKGERRSEDRSEAEGVLRTEFRYGAFERVIPLPAQVKNTEAQADYQNGILVLTLPKRDEELHKVVKVDLG |