| Read Date | 2009-06-30 10:06:00 |
|---|---|
| Read Number | X0000111141490200906301006 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1333 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| PEG 8000 | 7.5 | 10.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Ethylene Glycol | 7.5 | 8.0 % (v/v) | C(CO)O |
![]() | NsR39A |
|---|---|
| Spine Status | HSQC collected |
| Length | 126 aa |
| Mass | 13.69 kD |
| ext | 8480 |
| pI | 4.46 |
| Name | Microtubule-associated protein tau (Neurofibrillary tangle protein)(Paired helical filament-tau) (PHF-tau) |
| Database References | NCBI UniProt |
| PFAM | PF04536 |
| PDB Structures | 3PTJ (Best Match) |
| Gene | |
|---|---|
| Organism | Nostoc sp. |
| Genus | Nostoc |
| Species | sp. PCC 7120 |
| Strain | |
| Sequence | DVISRINEGAISSSLEDLAKETGKEVRFVTIHRLDYGETPESFAQALFEKWFPSKEAQANQILLVLDTVTNGTAIITGDEVKPLLTDTIANSVAEETLAAPLRDGNKYNQAFLDASDRLVAVLSGQ |