| Read Date | 2009-07-10 09:26:00 |
|---|---|
| Read Number | X0000111381453200907100926 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0184 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Sodium phosphate monobasic | 6.0 | 2.2 M | [Na+].[O-]P(=O)(O)O |
![]() | GmR223A |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 91 aa |
| Mass | 10.04 kD |
| ext | 8480 |
| pI | 3.99 |
| Name | SubName: Full=Putative uncharacterized protein; |
| Database References | NCBI UniProt |
| PFAM | PF04459 |
| PDB Structures | 3ID4 (Best Match) |
| Gene | |
|---|---|
| Organism | Geobacter metallireducens |
| Genus | Geobacter |
| Species | metallireducens |
| Strain | |
| Sequence | MEGLLIDYVQPGSIAEELEIEAGDRLVAINGQDLRDIIDFSFYAHDEELALEIVKPSGDHWEAEIERDGDEPLGLVFAPPVPAQCGNKCVF |