| Read Date | 2009-07-14 10:39:00 |
|---|---|
| Read Number | X0000111501025200907141039 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0449 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.2 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Potassium phosphate dibasic anhydrous | 4.2 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… |
| PEG 8000 | 4.2 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | UuR17A |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 101 aa |
| Mass | 11.86 kD |
| ext | 13410 |
| pI | 8.74 |
| Name | Conserved hypothetical membrane lipoprotein |
| Database References | UniProt |
| PFAM | PF04200 |
| PDB Structures | 2KRT (NMR) 3JVC (Xray) 3K63 (Xray) |
| Gene | |
|---|---|
| Organism | Ureaplasma parvum |
| Genus | Ureaplasma |
| Species | parvum |
| Strain | |
| Sequence | VNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPY |