| Read Date | 2009-07-16 12:08:00 |
|---|---|
| Read Number | X0000111601132200907161208 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1507 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 4.6 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Lithium sulfate monohydrate | 4.6 | 0.8 M | [Li+].[Li+].[O-]S([O-])(=… |
![]() | LpR91B |
|---|---|
| Spine Status | X-Ray structure |
| Length | 101 aa |
| Mass | 11.40 kD |
| ext | 19940 |
| pI | 5.09 |
| Name | Hypothetical protein lp_0118 |
| Database References | NCBI UniProt |
| PFAM | PF08797 |
| PDB Structures | 3K2Y (Xray) |
| Gene | |
|---|---|
| Organism | Lactobacillus plantarum |
| Genus | Lactobacillus |
| Species | plantarum |
| Strain | |
| Sequence | TGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWR |