| Read Date | 2005-11-18 08:57:00 |
|---|---|
| Read Number | X0000061101303200511180857 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0746 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Zinc acetate dihydrate | 5.0 | 0.1 M | [Zn+2].[O-]C(=O)C.[O-]C(=… |
| PEG 1000 | 5.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | ER244 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 63 aa |
| Mass | 7.28 kD |
| ext | 11460 |
| pI | 6.08 |
| Name | Hypothetical protein yaiA |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2KVT (NMR) |
| Gene | |
|---|---|
| Organism | Escherichia coli |
| Genus | Escherichia |
| Species | coli |
| Strain | |
| Sequence | MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDPDKE |