 
    | Read Date | 2005-11-18 08:58:00 | 
|---|---|
| Read Number | X0000061101328200511180858 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1520 | 
| Screen | HWI Generation 6 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| di-Ammonium Tartrate | 7.0 | 0.7 M | O=C([O-])C(O)C(O)C([O-])=… | 
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… | 
|  | ER244 | 
|---|---|
| Spine Status | NMR structure and crystal hits | 
| Length | 63 aa | 
| Mass | 7.28 kD | 
| ext | 11460 | 
| pI | 6.08 | 
| Name | Hypothetical protein yaiA | 
| Database References | NCBI UniProt | 
| PFAM | |
| PDB Structures | 2KVT (NMR) | 
| Gene | |
|---|---|
| Organism | Escherichia coli | 
| Genus | Escherichia | 
| Species | coli | 
| Strain | |
| Sequence | MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDPDKE |