| Read Date | 2009-07-23 14:37:00 |
|---|---|
| Read Number | X0000111891532200907231437 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1535 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
| Tacsimate | 7.0 | 35.0 % (v/v) | missing |
![]() | LmR64B |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 63 aa |
| Mass | 7.10 kD |
| ext | 7450 |
| pI | 6.32 |
| Name | Putative peptidoglycan bound protein (LPXTG motif) |
| Database References | NCBI UniProt |
| PFAM | PF13461 |
| PDB Structures | 2KVZ (NMR) |
| Gene | |
|---|---|
| Organism | Listeria monocytogenes |
| Genus | Listeria |
| Species | monocytogenes |
| Strain | |
| Sequence | FGKPNQVTVNYLDENKTPIAPSLYLSGLFNEAYNVPMKKIKGYTLLKYDSEILGVFTESPQTI |