| Read Date | 2009-08-04 09:41:00 |
|---|---|
| Read Number | X0000112071421200908040941 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0476 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium nitrate | 7.0 | 0.1 M | [O-][N+]([O-])=O.[NH4+] |
| PEG 8000 | 7.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | GtR2 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 215 aa |
| Mass | 24.05 kD |
| ext | 28420 |
| pI | 4.67 |
| Name | Thiamin pyrophosphokinase |
| Database References | NCBI UniProt |
| PFAM | PF04263 |
| PDB Structures | 3K94 (Xray) |
| Gene | |
|---|---|
| Organism | Geobacillus thermodenitrificans |
| Genus | Geobacillus |
| Species | thermodenitrificans |
| Strain | |
| Sequence | MIIHIVGGGPRELLPDLRFYDGEDVCWVGVDRGTMTLLEAGFRPVRAFGDFDSLPAEDVVKLQQAFPDLDVWPAEKDKTDMEIALDWAVEQTARCIRLFGATGGRLDHLFGNVELLLKYADRPIEIVDRQNVLTVHLPGTYTVMYDARYCYVSYIPVSETVAEFTLTGFKYPLTNCHISRGSTLCISNELIQSSGTFSFSEGILMMIRSSDSSCL |