| Read Date | 2009-08-07 12:54:00 |
|---|---|
| Read Number | X0000112211365200908071254 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0090 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese chloride tetrahydrate | 5.0 | 2.5 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | BhR97D |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 82 aa |
| Mass | 9.29 kD |
| ext | 4470 |
| pI | 4.37 |
| Name | BH0266 protein |
| Database References | NCBI UniProt |
| PFAM | PF07949 |
| PDB Structures | 2KQ1 (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | LELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQL |