| Read Date | 2009-08-13 12:44:00 |
|---|---|
| Read Number | X0000112371495200908131244 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0758 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium phosphate tribasic | 7.0 | 0.1 M | [K+].[K+].[K+].[O-]P([O-]… |
| PEG 1000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | DhR29B |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 79 aa |
| Mass | 8.68 kD |
| ext | 4470 |
| pI | 5.19 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF07949 |
| PDB Structures | 2KPU (NMR) 2L5N (NMR) 3LYW (Xray) |
| Gene | |
|---|---|
| Organism | Desulfitobacterium hafniense |
| Genus | Desulfitobacterium |
| Species | hafniense |
| Strain | |
| Sequence | FPLALIAKNTPANSMIMTKLPSVKVKTEGYNPSVNVNELFAYVDLSGSEPGEHDYEVKVDPIPNIKIVEISPRVVTLQL |