| Read Date | 2009-08-14 09:55:00 |
|---|---|
| Read Number | X0000112401445200908140955 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0182 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic | 7.0 | 3.3 M | [Na+].[O-]P(=O)(O)O |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | BcR147A |
|---|---|
| Spine Status | NMR structure |
| Length | 84 aa |
| Mass | 9.00 kD |
| ext | 2980 |
| pI | 4.85 |
| Name | Bacillolysin (EC 3.4.24.28) |
| Database References | NCBI UniProt |
| PFAM | PF02868 |
| PDB Structures | 2KPN (NMR) |
| Gene | |
|---|---|
| Organism | Bacillus cereus |
| Genus | Bacillus |
| Species | cereus |
| Strain | |
| Sequence | SDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVK |