| Read Date | 2009-08-20 09:39:00 |
|---|---|
| Read Number | X0000112721323200908200939 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0751 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Cobalt (II) sulfate heptahydrate | 7.0 | 0.1 M | [Co+2].[O-]S([O-])(=O)=O.… |
| PEG 1000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | ErR9A |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 109 aa |
| Mass | 11.86 kD |
| ext | 11460 |
| pI | 5.44 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF00717 |
| PDB Structures | 2KPJ (NMR) |
| Gene | |
|---|---|
| Organism | Clostridium leptum |
| Genus | Eubacterium |
| Species | rectale |
| Strain | |
| Sequence | FSENLNSYIAKSEKTQLEIAKSIGVSPQTFNTWCKGIAIPRMGKVQALADYFNINKSDLIEDKKLNIDTVPIESGYTIPVLGRVAAGYGKEAVEEVIGQIEISPSMAAK |