| Read Date | 2009-09-17 12:28:00 |
|---|---|
| Read Number | X0000112750604200909171228 |
| Week | 5 |
| Verified Crystal | Crystal |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1003 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| 3,5-Dinitrosalicylic acid | 6.8 | 0.2 % (w/v) | c1c(cc(c(c1C(=O)O)O)[N+](… |
| Naphthalene-1,3,6-trisulfonic acid trisodium salt hydrate | 6.8 | 0.2 % (w/v) | [Na+].[Na+].[Na+].[O-]S(=… |
| 3-Indolebutyric acid | 6.8 | 0.2 % (w/v) | C1=CC=C2C(=C1)C(=CN2)CCCC… |
| trans-1,2-Cyclohexanedicarboxylic acid | 6.8 | 0.2 % (w/v) | C1CCC(C(C1)C(=O)O)C(=O)O |
![]() | DR64A |
|---|---|
| Spine Status | X-Ray structure |
| Length | 57 aa |
| Mass | 6.55 kD |
| ext | 2980 |
| pI | 4.72 |
| Name | Ribosome-associated factor Y |
| Database References | NCBI UniProt |
| PFAM | PF02482 |
| PDB Structures | 3LYV (Xray) |
| Gene | |
|---|---|
| Organism | Streptococcus pyogenes |
| Genus | Streptococcus |
| Species | pyogenes |
| Strain | |
| Sequence | QVVRTKNVTLKPMDVEEARLQMELLGHDFFIYTDSEDGATNILYRREDGNLGLIEAK |