| Read Date | 2009-09-17 12:33:00 |
|---|---|
| Read Number | X0000112750299200909171233 |
| Week | 5 |
| Verified Crystal | Crystal |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0303 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Lithium sulfate monohydrate | 6.0 | 0.1 M | [Li+].[Li+].[O-]S([O-])(=… |
| PEG 20000 | 6.0 | 12.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | DR64A |
|---|---|
| Spine Status | X-Ray structure |
| Length | 57 aa |
| Mass | 6.55 kD |
| ext | 2980 |
| pI | 4.72 |
| Name | Ribosome-associated factor Y |
| Database References | NCBI UniProt |
| PFAM | PF02482 |
| PDB Structures | 3LYV (Xray) |
| Gene | |
|---|---|
| Organism | Streptococcus pyogenes |
| Genus | Streptococcus |
| Species | pyogenes |
| Strain | |
| Sequence | QVVRTKNVTLKPMDVEEARLQMELLGHDFFIYTDSEDGATNILYRREDGNLGLIEAK |