| Read Date | 2009-08-21 09:29:00 |
|---|---|
| Read Number | X0000112811377200908210929 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0093 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese chloride tetrahydrate | 5.0 | 1.3 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | HR2938D |
|---|---|
| Spine Status | good HSQC collected |
| Length | 79 aa |
| Mass | 9.23 kD |
| ext | 2980 |
| pI | 5.14 |
| Name | Caspase-10 precursor (EC 3.4.22.-) (CASP-10) (ICE-like apoptoticprotease 4) (Apoptotic protease Mch-4) (FAS-associated death domainprotein interleukin-1B-converting enzyme 2) (FLICE2) [Contains:Caspase-10 subunit p23/17; Caspase-10 subunit p12] |
| Database References | NCBI UniProt |
| PFAM | PF01335 |
| PDB Structures | 2LS7 (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | FRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKA |