| Read Date | 2009-08-27 09:08:00 |
|---|---|
| Read Number | X0000112981443200908270908 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0373 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 5.6 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Ammonium phosphate monobasic | 5.6 | 0.7 M | [O-]P(=O)(O)O.[NH4+] |
| Glycerol anhydrous | 5.6 | 30.0 % (v/v) | C(C(CO)O)O |
![]() | VpR137B |
|---|---|
| Spine Status | HSQC collected |
| Length | 77 aa |
| Mass | 8.59 kD |
| ext | 5960 |
| pI | 8.55 |
| Name | Putative glutamate synthetase |
| Database References | NCBI UniProt |
| PFAM | PF09360 |
| PDB Structures | 3TBN (Best Match) |
| Gene | |
|---|---|
| Organism | Vibrio parahaemolyticus |
| Genus | Vibrio |
| Species | parahaemolyticus |
| Strain | |
| Sequence | MSKPIIADNKPIKVELKAGQEYYFCRCGRSKKQPYCDGSHSGTGMKPMSFTAEKDEDAYLCQCKHTANAPFCDGTHK |