| Read Date | 2009-09-04 09:26:00 |
|---|---|
| Read Number | X0000113151176200909040926 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1038 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Mellitic acid | 6.8 | 0.2 % (w/v) | O=C(O)c1c(c(c(c(c1C(=O)O)… |
| trans-Cinnamic acid | 6.8 | 0.2 % (w/v) | O=C(O)\C=C\c1ccccc1 |
| Pimelic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCC(=O)O |
| Glutaric acid | 6.8 | 0.2 % (w/v) | C(CC(=O)O)CC(=O)O |
| Sebacic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCCCC(=O)O |
| Oxalic acid anhydrous | 6.8 | 0.2 % (w/v) | C(=O)(C(=O)O)O |
![]() | CpR74B |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 55 aa |
| Mass | 6.10 kD |
| ext | 11460 |
| pI | 6.30 |
| Name | Bacteriocin BCN5 |
| Database References | NCBI UniProt |
| PFAM | PF01510 |
| PDB Structures | 2KRS (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium perfringens |
| Genus | Clostridium |
| Species | perfringens |
| Strain | |
| Sequence | VNSALNMRSGPGSNYGVIGTLRNNDEVEIIKEVDGWYEIKFNGKSGYVSSQYIKV |