| Read Date | 2005-12-09 09:42:00 |
|---|---|
| Read Number | X0000062151261200512090942 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0172 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Sodium molybdate dihydrate | 8.0 | 0.7 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
![]() | HsR14 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 92 aa |
| Mass | 10.38 kD |
| ext | 1490 |
| pI | 4.75 |
| Name | Vng1086c |
| Database References | NCBI UniProt |
| PFAM | PF01893 |
| PDB Structures | 2GF4 (Xray) |
| Gene | |
|---|---|
| Organism | Halobacterium salinarium |
| Genus | Halobacterium |
| Species | sp. |
| Strain | |
| Sequence | MHKDELLELHEQMVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNALAAAMSEDEFSSAGRISKRMEELADDASNQL |