| Read Date | 2009-09-23 09:39:00 |
|---|---|
| Read Number | X0000113761300200909230939 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1513 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 4.6 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Magnesium sulfate heptahydrate | 4.6 | 1.0 M | [Mg+2].[O-]S([O-])(=O)=O.… |
![]() | MrR70A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 103 aa |
| Mass | 11.62 kD |
| ext | 4470 |
| pI | 4.90 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF04455 |
| PDB Structures | 3MGJ (Best Match) |
| Gene | |
|---|---|
| Organism | Methanococcus maripaludis |
| Genus | Methanococcus |
| Species | maripaludis |
| Strain | |
| Sequence | MFMREIELKGHIIDSFILAKVFDRTLELGGDYKVLEFDIGKKKIDTSYAKLLISGDTQQHLDQILEELQNVGANIPEIENANLKPALKDSVLPDGFYSTTNHP |