| Read Date | 2009-09-23 10:35:00 |
|---|---|
| Read Number | X0000113781110200909231035 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1310 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 5.6 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Ammonium sulfate | 5.6 | 2.0 M | O=S(=O)(O)O.N.N |
| Potassium sodium tartrate tetrahydrate | 5.6 | 0.2 M | [K+].[Na+].O=C([O-])[C@H]… |
![]() | EsR4C |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 114 aa |
| Mass | 12.93 kD |
| ext | 1490 |
| pI | 5.36 |
| Name | SubName: Full=Putative uncharacterized protein; |
| Database References | NCBI UniProt |
| PFAM | PF11977 |
| PDB Structures | 3PM9 (Best Match) |
| Gene | |
|---|---|
| Organism | Methanobrevibacter smithii |
| Genus | Methanobrevibacter |
| Species | smithii |
| Strain | |
| Sequence | NILAAVKSLEESGDEFVIIADASLRHDIDDKEKFEKLLESENVEEVPAGNDADHFILNIAHNEKAKILSNDKFRDYAAEFKNINSMRIPFVIENGRVTFGKPKSPKKDKNILQH |