| Read Date | 2005-12-09 10:43:00 |
|---|---|
| Read Number | X0000062171200200512091043 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1044 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 8.2 | 0.0 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 8.2 | 1.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SR412 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 72 aa |
| Mass | 8.08 kD |
| ext | 2980 |
| pI | 4.33 |
| Name | YopT protein |
| Database References | NCBI UniProt |
| PFAM | PF09467 |
| PDB Structures | 2DLB (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MAGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE |