| Read Date | 2009-09-24 10:18:00 |
|---|---|
| Read Number | X0000113861339200909241018 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0755 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Lithium sulfate monohydrate | 7.0 | 0.1 M | [Li+].[Li+].[O-]S([O-])(=… |
| PEG 1000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | HR3356E |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 160 aa |
| Mass | 17.72 kD |
| ext | 16960 |
| pI | 7.22 |
| Name | RecName: Full=Calpain-10; EC=3.4.22.-;AltName: Full=Calcium-activated neutral proteinase 10; Short=CANP 10; |
| Database References | UniProt |
| PFAM | PF00648 |
| PDB Structures | 1QXP (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | EWGTVQLRGSWRVGQTAGGSRNFASYPTNPCFPFSVPEGPGPRCVRITLHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPLLSCVPHRYAQEVSRLCLLPAGTYKVVPSTYLPDTEGAFTVTIATRIDRPSIHSQEMLGQFLQEVSVMAVMKT |