| Read Date | 2009-09-24 11:33:00 |
|---|---|
| Read Number | X0000113891415200909241133 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0666 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Rubidium chloride | 7.0 | 0.1 M | [Rb+].[Cl-] |
| PEG 4000 | 7.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | SaR39B |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 114 aa |
| Mass | 12.48 kD |
| ext | 8940 |
| pI | 6.75 |
| Name | Hypothetical protein gbs0903 |
| Database References | NCBI UniProt |
| PFAM | PF07949 |
| PDB Structures | 4QDY (Best Match) |
| Gene | |
|---|---|
| Organism | Streptococcus agalactiae |
| Genus | Streptococcus |
| Species | agalactiae |
| Strain | |
| Sequence | TATSMNHQDNSKIAGASETYTHTLTDVPIDIKYDSDDYFISGYSYGADVYMSSVNRVKLDSEINEDTRKFKVVADLTNMKPGTHKVPLKVVNLPSGVNATVSPTTITVTMGKKK |