 
    | Read Date | 2009-09-24 11:35:00 | 
|---|---|
| Read Number | X0000113891225200909241135 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0463 | 
| Screen | HWI Generation 9 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium acetate trihydrate | 4.6 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O | 
| Sodium formate | 4.6 | 1.4 M | [Na+].[O-]C=O | 
| Glycerol anhydrous | 4.6 | 30.0 % (v/v) | C(C(CO)O)O | 
|  | SaR39B | 
|---|---|
| Spine Status | good HSQC collected and crystal hits | 
| Length | 114 aa | 
| Mass | 12.48 kD | 
| ext | 8940 | 
| pI | 6.75 | 
| Name | Hypothetical protein gbs0903 | 
| Database References | NCBI UniProt | 
| PFAM | PF07949 | 
| PDB Structures | 4QDY (Best Match) | 
| Gene | |
|---|---|
| Organism | Streptococcus agalactiae | 
| Genus | Streptococcus | 
| Species | agalactiae | 
| Strain | |
| Sequence | TATSMNHQDNSKIAGASETYTHTLTDVPIDIKYDSDDYFISGYSYGADVYMSSVNRVKLDSEINEDTRKFKVVADLTNMKPGTHKVPLKVVNLPSGVNATVSPTTITVTMGKKK |