| Read Date | 2009-09-24 13:23:00 |
|---|---|
| Read Number | X0000113921104200909241323 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1128 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 8.2 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic trihydrate | 8.2 | 1.7 M | [K+].O.O.O.[K+].[O-]P([O-… |
![]() | PfR163B |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 140 aa |
| Mass | 15.57 kD |
| ext | 12950 |
| pI | 9.03 |
| Name | Putative regulatory protein |
| Database References | NCBI UniProt |
| PFAM | PF05763 |
| PDB Structures | 3HKZ (Best Match) |
| Gene | |
|---|---|
| Organism | Pyrococcus furiosus |
| Genus | Pyrococcus |
| Species | furiosus |
| Strain | |
| Sequence | GKNSPNLKPGGYIVSASKSFSIDYSKAVAITRNPEIYKNIGIPYIWISKVEGENAISPTNLPKLLHTMISLSKKHPGVTFIIDSVEYLALENGFESTFKFLISAKDHLMLNNSSLVLIIEDKAFKPNELALLKKEFKEIS |