 
    | Read Date | 2009-10-05 09:49:00 | 
|---|---|
| Read Number | X0000114061163200910050949 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0267 | 
| Screen | HWI Generation 9 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Potassium acetate | 7.0 | 0.1 M | CC(=O)[O-].[K+] | 
| PEG 20000 | 7.0 | 12.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… | 
|  | PfR163B | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 140 aa | 
| Mass | 15.57 kD | 
| ext | 12950 | 
| pI | 9.03 | 
| Name | Putative regulatory protein | 
| Database References | NCBI UniProt | 
| PFAM | PF05763 | 
| PDB Structures | 3HKZ (Best Match) | 
| Gene | |
|---|---|
| Organism | Pyrococcus furiosus | 
| Genus | Pyrococcus | 
| Species | furiosus | 
| Strain | |
| Sequence | GKNSPNLKPGGYIVSASKSFSIDYSKAVAITRNPEIYKNIGIPYIWISKVEGENAISPTNLPKLLHTMISLSKKHPGVTFIIDSVEYLALENGFESTFKFLISAKDHLMLNNSSLVLIIEDKAFKPNELALLKKEFKEIS |