| Read Date | 2009-10-08 11:27:00 |
|---|---|
| Read Number | X0000114181168200910081127 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1036 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Pyromellitic acid | 6.8 | 0.2 % (w/v) | O=C(O)c1cc(c(cc1C(=O)O)C(… |
| 3-Indolebutyric acid | 6.8 | 0.2 % (w/v) | C1=CC=C2C(=C1)C(=CN2)CCCC… |
| Hexadecanedioic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCCCCCCCCCC(=O)… |
| Oxamic acid | 6.8 | 0.2 % (w/v) | O=C(N)C(=O)O |
| Sebacic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCCCC(=O)O |
| Suberic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCC(=O)O |
![]() | TeR219A |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 134 aa |
| Mass | 15.69 kD |
| ext | 27390 |
| pI | 4.70 |
| Name | RecName: Full=Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod; |
| Database References | NCBI UniProt |
| PFAM | PF00427 |
| PDB Structures | 2L8V (NMR) |
| Gene | |
|---|---|
| Organism | Thermosynechococcus elongatus |
| Genus | Thermosynechococcus |
| Species | elongatus |
| Strain | |
| Sequence | PVELRANWSEEDLETVIRAVYRQVLGNDYVMASERLVSAESLLRNGKITVREFVRAVAKSELYKEKFLYGNFQTRVIELNYKHLLGRAPYDESEVIFHLDLYENEGFDADIDSYIDSPEYTNSFGDWVVPYYRG |