| Read Date | 2009-10-09 10:18:00 |
|---|---|
| Read Number | X0000114211496200910091018 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1526 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 1.2 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | HmR36A |
|---|---|
| Spine Status | aggregation screening |
| Length | 103 aa |
| Mass | 11.39 kD |
| ext | 2980 |
| pI | 4.63 |
| Name | Lysine-ketoglutarate reductase/saccharopine dehydrogenase (EC 1.5.1.7)(EC 1.5.1.10) |
| Database References | NCBI UniProt |
| PFAM | PF04455 |
| PDB Structures | 3MGJ (Best Match) |
| Gene | |
|---|---|
| Organism | Haloarcula marismortui |
| Genus | Haloarcula |
| Species | marismortui |
| Strain | |
| Sequence | TVSREVELEGHIIDSGMMQSCFGIIMDLGGSFSVQKFDIGRHKDEESYARMLVEADDEAQLQSIVHELHQHGVNPSDPKDATLVPAPDDQVVPHGFYSTTNHP |