Read Date | 2009-11-09 14:17:00 |
---|---|
Read Number | X0000115010964200911091417 |
Week | <nil> |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 10_C1021 |
Screen | HWI Generation 10 |
Name | pH | Concentration | SMILES |
---|---|---|---|
HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
Methylenediphosphonic acid | 6.8 | 0.2 % (w/v) | O=P(O)(O)CP(=O)(O)O |
Sodium pyrophosphate tetrabasic decahydrate | 6.8 | 0.2 % (w/v) | [Na+].[Na+].[Na+].[Na+].[… |
Phytic acid sodium salt hydrate | 6.8 | 0.2 % (w/v) | [Na+].[Na+].[Na+].[Na+].[… |
Sodium triphosphate pentabasic | 6.8 | 0.2 % (w/v) | [Na+].[Na+].[Na+].[Na+].[… |
![]() | HR5554A |
---|---|
Spine Status | NMR structure and crystal hits |
Length | 165 aa |
Mass | 18.84 kD |
ext | 15470 |
pI | 5.96 |
Name | Enhancer of filamentation 1 (HEF1) (CRK-associated substrate-relatedprotein) (CAS-L) (CasL) (p105) (Protein NEDD9) (Renal carcinomaantigen NY-REN-12) |
Database References | NCBI UniProt |
PFAM | PF12026 |
PDB Structures | 2L81 (NMR) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | DKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS |