| Read Date | 2009-11-23 12:23:00 |
|---|---|
| Read Number | X0000115010984200911231223 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C1026 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| Glycerol anhydrous | 6.8 | 0.2 % (w/v) | C(C(CO)O)O |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| D-Sorbitol | 6.8 | 0.2 % (w/v) | O[C@H]([C@@H](O)CO)[C@H](… |
| 1,2,3-Heptanetriol | 6.8 | 0.2 % (w/v) | OC(CCCC)C(O)CO |
| (±)-2-Methyl-2,4-pentanediol | 6.8 | 0.2 % (w/v) | CC(O)CC(C)(C)O |
| Diethylenetriaminepentakis(methylphosphonic acid) | 6.8 | 0.2 % (w/v) | O=P(O)(O)CN(CP(=O)(O)O)CC… |
![]() | HR5554A |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 165 aa |
| Mass | 18.84 kD |
| ext | 15470 |
| pI | 5.96 |
| Name | Enhancer of filamentation 1 (HEF1) (CRK-associated substrate-relatedprotein) (CAS-L) (CasL) (p105) (Protein NEDD9) (Renal carcinomaantigen NY-REN-12) |
| Database References | NCBI UniProt |
| PFAM | PF12026 |
| PDB Structures | 2L81 (NMR) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | DKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS |