| Read Date | 2009-11-10 14:53:00 |
|---|---|
| Read Number | X0000115081372200911101453 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C1051 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| 1,3,5-Pentanetricarboxylic acid | 7.0 | 0.1 % (w/v) | O=C(O)CCC(C(=O)O)CCC(=O)O |
| Azelaic acid | 7.0 | 0.1 % (w/v) | O=C(O)CCCCCCCC(=O)O |
| Pimelic acid | 7.0 | 0.1 % (w/v) | O=C(O)CCCCCC(=O)O |
| Dodecanedioic acid | 7.0 | 0.1 % (w/v) | O=C(O)CCCCCCCCCCC(=O)O |
| Glutaric acid | 7.0 | 0.1 % (w/v) | C(CC(=O)O)CC(=O)O |
| Hexadecanedioic acid | 7.0 | 0.1 % (w/v) | O=C(O)CCCCCCCCCCCCCCC(=O)… |
| Sebacic acid | 7.0 | 0.1 % (w/v) | O=C(O)CCCCCCCCC(=O)O |
| Suberic acid | 7.0 | 0.1 % (w/v) | O=C(O)CCCCCCC(=O)O |
| Tacsimate | 7.0 | 55.0 % (v/v) | missing |
![]() | BfR162 |
|---|---|
| Spine Status | aggregation screening |
| Length | 300 aa |
| Mass | 33.49 kD |
| ext | 37360 |
| pI | 4.82 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 3PNN (Best Match) |
| Gene | |
|---|---|
| Organism | Bacteroides fragilis |
| Genus | Bacteroides |
| Species | fragilis |
| Strain | |
| Sequence | MKPTLFVLAAGMGSRYGGLKQLDGLGPNGETIMDYSIYDAIRGGFGKVVFVIRKDFEQDFREKILSKYENHIPVELVFQALDNLPEGFTCPADRVKPWGTNHAVLMGKDVIKEPFAVINADDFYGRDSFAVLGAELSQMDGKKNDYCMVGYRVGNTLSESGSVARGVCETNAEGYLTTVVERTAIERIDGKVSFKDENGEMQTIGDNTPVSMNMWGFTPDYFAYSEEYFKEFLKENEGNLKSEYFIPLMVNKLVNEGTARVKVLDTTSKWFGVTYAADRQGVVDKIQALVDAGEYPDKLF |