| Read Date | 2009-11-12 19:14:00 |
|---|---|
| Read Number | X0000115221485200911121914 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C0192 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium thiosulfate pentahydrate | 7.0 | 1.9 M | [Na+].[Na+].[O-]S([O-])(=… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | JR30 |
|---|---|
| Spine Status | good HSQC collected |
| Length | 161 aa |
| Mass | 17.97 kD |
| ext | 11460 |
| pI | 9.26 |
| Name | UPF0129 protein PH0709 |
| Database References | NCBI UniProt |
| PFAM | PF08745 |
| PDB Structures | 2LCQ (Best Match) |
| Gene | |
|---|---|
| Organism | Pyrococcus horikoshii |
| Genus | Pyrococcus |
| Species | horikoshi |
| Strain | |
| Sequence | MLRNLKKTLVLDSSVFIQGIDIEGYTTPSVVEEIKDRESKIFLESLISAGKVKIAEPSKESIDRIIQVAKETGEVNELSKADIEVLALAYELKGEIFSDDYNVQNIASLLGLRFRTLKRGIKKVIKWRYVCIGCGRKFSTLPPGGVCPDCGSKVKLIPRKR |