| Read Date | 2009-11-06 12:14:00 |
|---|---|
| Read Number | X0000115251059200911061214 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C0349 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Potassium phosphate monobasic | 9.0 | 0.1 M | [K+].[O-]P(=O)(O)O |
| PEG 20000 | 9.0 | 24.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | EwR82C |
|---|---|
| Spine Status | X-Ray structure |
| Length | 149 aa |
| Mass | 16.98 kD |
| ext | 25440 |
| pI | 4.71 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF05488 |
| PDB Structures | 3MFB (Xray) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | LLTPEKLLEAANKQGTVPSRVRYQWMEDEETGRLKAVGYHTSMESGRDQVRVRLLKHDFPNNRYEFWEEGATGPTILWTPDNPGIELPTDTAHGEQPVIPSAIPGLEIPEMDDVSILATPMPDEKDFRDYILVFPENAFPPIYVYLSKK |