| Read Date | 2009-11-09 09:45:00 |
|---|---|
| Read Number | X0000115291249200911090945 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C0169 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium molybdate dihydrate | 7.0 | 1.4 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | EwR82C |
|---|---|
| Spine Status | X-Ray structure |
| Length | 149 aa |
| Mass | 16.98 kD |
| ext | 25440 |
| pI | 4.71 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF05488 |
| PDB Structures | 3MFB (Xray) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | LLTPEKLLEAANKQGTVPSRVRYQWMEDEETGRLKAVGYHTSMESGRDQVRVRLLKHDFPNNRYEFWEEGATGPTILWTPDNPGIELPTDTAHGEQPVIPSAIPGLEIPEMDDVSILATPMPDEKDFRDYILVFPENAFPPIYVYLSKK |