| Read Date | 2005-07-01 09:02:00 |
|---|---|
| Read Number | X0000052581371200507010902 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C0283 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES hydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Potassium phosphate monobasic | 6.0 | 0.1 M | [K+].[O-]P(=O)(O)O |
| PEG 20000 | 6.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | JR18 |
|---|---|
| Spine Status | aggregation screening |
| Length | 136 aa |
| Mass | 16.01 kD |
| ext | 23950 |
| pI | 8.65 |
| Name | Hypothetical UPF0066 protein PH1056 |
| Database References | NCBI UniProt |
| PFAM | PF01980 |
| PDB Structures | 2NV4 (Best Match) |
| Gene | |
|---|---|
| Organism | Pyrococcus horikoshii |
| Genus | Pyrococcus |
| Species | horikoshi |
| Strain | |
| Sequence | MKFEAFKIVPVGYIRKEKNVFIEILPEFREGMEGLREGDWIKLILWFHKSDTPELRRILKVHPHGNPENPLTGVFATRSPFRPNPYTVKVHKIEGNRIYIDWIDAEDGTPVSDIKIFPERYDCPKENYQSTSRLKS |